PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009774394.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 286aa    MW: 31656.2 Da    PI: 7.0377
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009774394.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.93e-4052112262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     +++ lkcprCdst+tkfCyynnysl+qPryfCk+CrryWtkGG+lrn+PvGgg+rknkk+s
  XP_009774394.1  52 HDQPLKCPRCDSTHTKFCYYNNYSLTQPRYFCKSCRRYWTKGGTLRNIPVGGGCRKNKKVS 112
                     7899******************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2746106IPR003851Zinc finger, Dof-type
PfamPF027011.6E-3353110IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.21756110IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105894IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MGITSLQVCM DSSNWLQDTV HEETELDSSS SPSGDIFTCS RPLIERKLRP QHDQPLKCPR  60
CDSTHTKFCY YNNYSLTQPR YFCKSCRRYW TKGGTLRNIP VGGGCRKNKK VSSKKLSNEN  120
ATNYQNPGSS SSSISNFPEM AFSHFTNFMG NNNPSNFMLE NPAPIDFMES KYETLVGSSR  180
NQDFLVNVDQ LGMINGYGDI NGIAPNFHAG LCSTFGLPME GNIMNYDGQN AIDVKPNPKV  240
LSLEWHDQGC SNSGNKESFG YFNGGLGSWT GLMNNGYGSS GTNPLV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB9717100.0AB971710.1 Nicotiana tabacum NtBBF3 mRNA for Dof zinc finger protein, complete cds, cultivar: Samsun NN.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009774394.10.0PREDICTED: dof zinc finger protein DOF5.6-like
RefseqXP_016473208.10.0PREDICTED: dof zinc finger protein DOF5.6-like
TrEMBLA0A0B6VJP10.0A0A0B6VJP1_TOBAC; Dof zinc finger protein
STRINGVIT_17s0000g08290.t011e-125(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48952240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.11e-46Dof family protein